Lineage for d2ljra1 (2ljr A:80-244)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713472Protein Class theta GST [81350] (1 species)
  7. 2713473Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries)
  8. 2713474Domain d2ljra1: 2ljr A:80-244 [17709]
    Other proteins in same PDB: d2ljra2, d2ljrb2

Details for d2ljra1

PDB Entry: 2ljr (more details), 3.2 Å

PDB Description: glutathione transferase apo-form from human
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2ljra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}
tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam
dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea
flgaelcqeahsiilsileqaakktlptpspeayqamllriarip

SCOPe Domain Coordinates for d2ljra1:

Click to download the PDB-style file with coordinates for d2ljra1.
(The format of our PDB-style files is described here.)

Timeline for d2ljra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ljra2