![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class theta GST [81350] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47629] (3 PDB entries) |
![]() | Domain d2ljra1: 2ljr A:80-244 [17709] Other proteins in same PDB: d2ljra2, d2ljrb2 |
PDB Entry: 2ljr (more details), 3.2 Å
SCOPe Domain Sequences for d2ljra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} tpdhwypsdlqararvheylgwhadcirgtfgiplwvqvlgpligvqvpeekvernrtam dqalqwledkflgdrpflagqqvtladlmaleelmqpvalgyelfegrprlaawrgrvea flgaelcqeahsiilsileqaakktlptpspeayqamllriarip
Timeline for d2ljra1: