SCOPe 2.06: Domain d3gy5a_: 3gy5 A:

Lineage for d3gy5a_ (3gy5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
   Uniprot P00760

8. Domain d3gy5a_: 3gy5 A: [177089]
   automated match to d1aq7a_
   complexed with brn, ca, edo, so4

Details for d3gy5a_

PDB Entry: 3gy5, 1.57 Å

PDB Description: A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by X-ray crystallography and ITC

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3gy5a_:

Sequence; same for both SEQRES and ATOM records:

>d3gy5a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3gy5a_:

• d3gy5a_ first appeared in SCOPe 2.01
  
• d3gy5a_ appears in SCOPe 2.05
  
• d3gy5a_ appears in SCOPe 2.07
  
• d3gy5a_ appears in the current release, SCOPe 2.08