Lineage for d3gxub_ (3gxu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772145Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF00812
  6. 2772151Protein Ephrin-b2 ectodomain [74875] (2 species)
  7. 2772152Species Human (Homo sapiens) [TaxId:9606] [190026] (4 PDB entries)
  8. 2772154Domain d3gxub_: 3gxu B: [177080]
    Other proteins in same PDB: d3gxua_
    automated match to d1ikop_

Details for d3gxub_

PDB Entry: 3gxu (more details), 2.5 Å

PDB Description: Crystal structure of Eph receptor and ephrin complex
PDB Compounds: (B:) ephrin-b2

SCOPe Domain Sequences for d3gxub_:

Sequence, based on SEQRES records: (download)

>d3gxub_ b.6.1.5 (B:) Ephrin-b2 ectodomain {Human (Homo sapiens) [TaxId: 9606]}
sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
drctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegld
nqeggvcqtramkilmkvgqdas

Sequence, based on observed residues (ATOM records): (download)

>d3gxub_ b.6.1.5 (B:) Ephrin-b2 ectodomain {Human (Homo sapiens) [TaxId: 9606]}
sivlepiywnssnskflpgqglvlypqigdkldiicpkvtvqyeyykvymvdkdqadrct
ikentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqegg
vcqtramkilmkvgqdas

SCOPe Domain Coordinates for d3gxub_:

Click to download the PDB-style file with coordinates for d3gxub_.
(The format of our PDB-style files is described here.)

Timeline for d3gxub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gxua_