Lineage for d3gxua_ (3gxu A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039222Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 protein domains)
    automatically mapped to Pfam PF01404
  6. 2039236Protein automated matches [190969] (1 species)
    not a true protein
  7. 2039237Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 2039257Domain d3gxua_: 3gxu A: [177079]
    Other proteins in same PDB: d3gxub_
    automated match to d1kgya_

Details for d3gxua_

PDB Entry: 3gxu (more details), 2.5 Å

PDB Description: Crystal structure of Eph receptor and ephrin complex
PDB Compounds: (A:) Ephrin type-A receptor 4

SCOPe Domain Sequences for d3gxua_:

Sequence, based on SEQRES records: (download)

>d3gxua_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw
itregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidti
aadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykk

Sequence, based on observed residues (ATOM records): (download)

>d3gxua_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw
itregaqrvyieikftlrdcnslpgtcketfnlyyyesdndkerfienqfvkidtiaade
sftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykk

SCOPe Domain Coordinates for d3gxua_:

Click to download the PDB-style file with coordinates for d3gxua_.
(The format of our PDB-style files is described here.)

Timeline for d3gxua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gxub_