SCOPe 2.08: Domain d3gxua_: 3gxu A:

Lineage for d3gxua_ (3gxu A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
   automatically mapped to Pfam PF01404

6. Protein automated matches [190969] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)

8. Domain d3gxua_: 3gxu A: [177079]
   Other proteins in same PDB: d3gxub_
   automated match to d1kgya_

Details for d3gxua_

PDB Entry: 3gxu, 2.5 Å

PDB Description: Crystal structure of Eph receptor and ephrin complex

PDB Compounds: (A:) Ephrin type-A receptor 4

SCOPe Domain Sequences for d3gxua_:

Sequence, based on SEQRES records:

>d3gxua_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw
itregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidti
aadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykk

Sequence, based on observed residues (ATOM records):

>d3gxua_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdw
itregaqrvyieikftlrdcnslpgtcketfnlyyyesdndkerfienqfvkidtiaade
sftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykk

Timeline for d3gxua_:

• d3gxua_ first appeared in SCOPe 2.01
  
• d3gxua_ appears in SCOPe 2.07