Lineage for d3gxrc_ (3gxr C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2173085Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 2173093Protein automated matches [191098] (3 species)
    not a true protein
  7. 2173094Species Atlantic cod (Gadus morhua) [TaxId:8049] [189087] (2 PDB entries)
  8. 2173097Domain d3gxrc_: 3gxr C: [177077]
    automated match to d153la_

Details for d3gxrc_

PDB Entry: 3gxr (more details), 1.7 Å

PDB Description: the crystal structure of g-type lysozyme from atlantic cod (gadus morhua l.) in complex with nag oligomers sheds new light on substrate binding and the catalytic mechanism. structure with nag to 1.7
PDB Compounds: (C:) Goose-type lysozyme 1

SCOPe Domain Sequences for d3gxrc_:

Sequence, based on SEQRES records: (download)

>d3gxrc_ d.2.1.5 (C:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
paviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatg
ilvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraq
wykkngf

Sequence, based on observed residues (ATOM records): (download)

>d3gxrc_ d.2.1.5 (C:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
paviaaiisresragnyngfglmqvdkryheprgawnseehidqatgilvnfiqliqkkf
pswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwykkngf

SCOPe Domain Coordinates for d3gxrc_:

Click to download the PDB-style file with coordinates for d3gxrc_.
(The format of our PDB-style files is described here.)

Timeline for d3gxrc_: