SCOPe 2.08: Domain d3gxrc_: 3gxr C:

Lineage for d3gxrc_ (3gxr C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.5: G-type lysozyme [53987] (2 proteins)

6. Protein automated matches [191098] (3 species)
   not a true protein

7. Species Atlantic cod (Gadus morhua) [TaxId:8049] [189087] (2 PDB entries)

8. Domain d3gxrc_: 3gxr C: [177077]
   automated match to d153la_

Details for d3gxrc_

PDB Entry: 3gxr, 1.7 Å

PDB Description: the crystal structure of g-type lysozyme from atlantic cod (gadus morhua l.) in complex with nag oligomers sheds new light on substrate binding and the catalytic mechanism. structure with nag to 1.7

PDB Compounds: (C:) Goose-type lysozyme 1

SCOPe Domain Sequences for d3gxrc_:

Sequence, based on SEQRES records:

>d3gxrc_ d.2.1.5 (C:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
paviaaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatg
ilvnfiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraq
wykkngf

Sequence, based on observed residues (ATOM records):

>d3gxrc_ d.2.1.5 (C:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
vgygditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvd
paviaaiisresragnyngfglmqvdkryheprgawnseehidqatgilvnfiqliqkkf
pswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwykkngf

Timeline for d3gxrc_:

• d3gxrc_ first appeared in SCOPe 2.01
  
• d3gxrc_ appears in SCOPe 2.07