Lineage for d3gxkb_ (3gxk B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926391Family d.2.1.5: G-type lysozyme [53987] (2 proteins)
  6. 2926399Protein automated matches [191098] (3 species)
    not a true protein
  7. 2926400Species Atlantic cod (Gadus morhua) [TaxId:8049] [189087] (2 PDB entries)
  8. 2926406Domain d3gxkb_: 3gxk B: [177071]
    automated match to d153la_
    complexed with co

Details for d3gxkb_

PDB Entry: 3gxk (more details), 1.9 Å

PDB Description: the crystal structure of g-type lysozyme from atlantic cod (gadus morhua l.) in complex with nag oligomers sheds new light on substrate binding and the catalytic mechanism. native structure to 1.9
PDB Compounds: (B:) Goose-type lysozyme 1

SCOPe Domain Sequences for d3gxkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gxkb_ d.2.1.5 (B:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]}
ditqvetsgassktsrqdkleydgvrashtmaqtdagrmekyksfinnvakkhvvdpavi
aaiisresragnvifnttppgwgdnyngfglmqvdkryheprgawnseehidqatgilvn
fiqliqkkfpswsteqqlkgaiaayntgdgrvesyesvdsrttgkdysndvvaraqwykk
ngf

SCOPe Domain Coordinates for d3gxkb_:

Click to download the PDB-style file with coordinates for d3gxkb_.
(The format of our PDB-style files is described here.)

Timeline for d3gxkb_: