SCOPe 2.08: Domain d3gxbb1: 3gxb B:1495-1671

Lineage for d3gxbb1 (3gxb B:1495-1671)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.0: automated matches [191586] (1 protein)
   not a true family

6. Protein automated matches [191045] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries)

8. Domain d3gxbb1: 3gxb B:1495-1671 [177069]
   Other proteins in same PDB: d3gxba2, d3gxbb2
   automated match to d1fnsa_
   complexed with nag, so4

Details for d3gxbb1

PDB Entry: 3gxb, 1.9 Å

PDB Description: crystal structure of vwf a2 domain

PDB Compounds: (B:) von willebrand factor

SCOPe Domain Sequences for d3gxbb1:

Sequence; same for both SEQRES and ATOM records:

>d3gxbb1 c.62.1.0 (B:1495-1671) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvldvafvlegsdkigeadfnrskefmeeviqrmdvgqdsihvtvlqysymvtveypfse
aqskgdilqrvreiryqggnrtntglalrylsdhsflvsqgdreqapnlvymvtgnpasd
eikrlpgdiqvvpigvgpnanvqelerigwpnapiliqdfetlpreapdlvlqrccs

Timeline for d3gxbb1:

• d3gxbb1 first appeared in SCOPe 2.01, called d3gxbb_
  
• d3gxbb1 appears in SCOPe 2.07