![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.0: automated matches [191586] (1 protein) not a true family |
![]() | Protein automated matches [191045] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188880] (10 PDB entries) |
![]() | Domain d3gxba1: 3gxb A:1495-1671 [177068] Other proteins in same PDB: d3gxba2, d3gxbb2 automated match to d1fnsa_ complexed with nag, so4 |
PDB Entry: 3gxb (more details), 1.9 Å
SCOPe Domain Sequences for d3gxba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gxba1 c.62.1.0 (A:1495-1671) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvldvafvlegsdkigeadfnrskefmeeviqrmdvgqdsihvtvlqysymvtveypfse aqskgdilqrvreiryqggnrtntglalrylsdhsflvsqgdreqapnlvymvtgnpasd eikrlpgdiqvvpigvgpnanvqelerigwpnapiliqdfetlpreapdlvlqrccs
Timeline for d3gxba1: