Lineage for d3gwyb_ (3gwy B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.113: Nudix [55810] (1 superfamily)
beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
contains beta-grasp motifSuperfamily d.113.1: Nudix [55811] (8 families) 
Family d.113.1.0: automated matches [191580] (1 protein)
not a true familyProtein automated matches [191036] (11 species)
not a true protein
Species Bacteroides fragilis [TaxId:272559] [188860] (1 PDB entry) 
Domain d3gwyb_: 3gwy B: [177066]
automated match to d1muta_
Details for d3gwyb_
PDB Entry: 3gwy (more details), 2 Å
PDB Description: crystal structure of putative ctp pyrophosphohydrolase from bacteroides fragilis
PDB Compounds: (B:) Putative CTP pyrophosphohydrolaseSCOPe Domain Sequences for d3gwyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gwyb_ d.113.1.0 (B:) automated matches {Bacteroides fragilis [TaxId: 272559]}
slksievvaavirlgekylcvqrgqtkfsytsfryefpggkveegeslqealqreimeem
dyvievgeklltvhhtypdfeitmhaflchpvgqryvlkehiaaqwlstremaildwaea
dkpivrkiseqeg
SCOPe Domain Coordinates for d3gwyb_:
Click to download the PDB-style file with coordinates for d3gwyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3gwyb_:
- d3gwyb_ first appeared in SCOPe 2.01
- d3gwyb_ appears in SCOPe 2.04
- d3gwyb_ is called d3gwyb1 in SCOPe 2.06
- d3gwyb_ appears in the current release, SCOPe 2.08, called d3gwyb1
View in 3D
