Lineage for d3gwyb_ (3gwy B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923249Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1923250Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1923546Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 1923547Protein automated matches [191036] (11 species)
    not a true protein
  7. 1923548Species Bacteroides fragilis [TaxId:272559] [188860] (1 PDB entry)
  8. 1923550Domain d3gwyb_: 3gwy B: [177066]
    automated match to d1muta_

Details for d3gwyb_

PDB Entry: 3gwy (more details), 2 Å

PDB Description: crystal structure of putative ctp pyrophosphohydrolase from bacteroides fragilis
PDB Compounds: (B:) Putative CTP pyrophosphohydrolase

SCOPe Domain Sequences for d3gwyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gwyb_ d.113.1.0 (B:) automated matches {Bacteroides fragilis [TaxId: 272559]}
slksievvaavirlgekylcvqrgqtkfsytsfryefpggkveegeslqealqreimeem
dyvievgeklltvhhtypdfeitmhaflchpvgqryvlkehiaaqwlstremaildwaea
dkpivrkiseqeg

SCOPe Domain Coordinates for d3gwyb_:

Click to download the PDB-style file with coordinates for d3gwyb_.
(The format of our PDB-style files is described here.)

Timeline for d3gwyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gwya_