SCOPe 2.08: Domain d3gwyb1: 3gwy B:2-130

Lineage for d3gwyb1 (3gwy B:2-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (17 species)
   not a true protein

7. Species Bacteroides fragilis [TaxId:272559] [188860] (1 PDB entry)

8. Domain d3gwyb1: 3gwy B:2-130 [177066]
   Other proteins in same PDB: d3gwya2, d3gwyb2, d3gwyb3
   automated match to d1muta_

Details for d3gwyb1

PDB Entry: 3gwy, 2 Å

PDB Description: crystal structure of putative ctp pyrophosphohydrolase from bacteroides fragilis

PDB Compounds: (B:) Putative CTP pyrophosphohydrolase

SCOPe Domain Sequences for d3gwyb1:

Sequence; same for both SEQRES and ATOM records:

>d3gwyb1 d.113.1.0 (B:2-130) automated matches {Bacteroides fragilis [TaxId: 272559]}
ksievvaavirlgekylcvqrgqtkfsytsfryefpggkveegeslqealqreimeemdy
vievgeklltvhhtypdfeitmhaflchpvgqryvlkehiaaqwlstremaildwaeadk
pivrkiseq

Timeline for d3gwyb1:

• d3gwyb1 first appeared in SCOPe 2.01, called d3gwyb_
  
• d3gwyb1 appears in SCOPe 2.07