Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (17 species) not a true protein |
Species Bacteroides fragilis [TaxId:272559] [188860] (1 PDB entry) |
Domain d3gwya1: 3gwy A:2-129 [177065] Other proteins in same PDB: d3gwya2, d3gwyb2, d3gwyb3 automated match to d1muta_ |
PDB Entry: 3gwy (more details), 2 Å
SCOPe Domain Sequences for d3gwya1:
Sequence, based on SEQRES records: (download)
>d3gwya1 d.113.1.0 (A:2-129) automated matches {Bacteroides fragilis [TaxId: 272559]} ksievvaavirlgekylcvqrgqtkfsytsfryefpggkveegeslqealqreimeemdy vievgeklltvhhtypdfeitmhaflchpvgqryvlkehiaaqwlstremaildwaeadk pivrkise
>d3gwya1 d.113.1.0 (A:2-129) automated matches {Bacteroides fragilis [TaxId: 272559]} ksievvaavirlgekylcvqrfryefpggkveegeslqealqreimeemdyvievgekll tvhhtypdfeitmhaflchpvgqryvlkehiaaqwlstremaildwaeadkpivrkise
Timeline for d3gwya1: