Lineage for d3gwya1 (3gwy A:2-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971793Species Bacteroides fragilis [TaxId:272559] [188860] (1 PDB entry)
  8. 2971794Domain d3gwya1: 3gwy A:2-129 [177065]
    Other proteins in same PDB: d3gwya2, d3gwyb2, d3gwyb3
    automated match to d1muta_

Details for d3gwya1

PDB Entry: 3gwy (more details), 2 Å

PDB Description: crystal structure of putative ctp pyrophosphohydrolase from bacteroides fragilis
PDB Compounds: (A:) Putative CTP pyrophosphohydrolase

SCOPe Domain Sequences for d3gwya1:

Sequence, based on SEQRES records: (download)

>d3gwya1 d.113.1.0 (A:2-129) automated matches {Bacteroides fragilis [TaxId: 272559]}
ksievvaavirlgekylcvqrgqtkfsytsfryefpggkveegeslqealqreimeemdy
vievgeklltvhhtypdfeitmhaflchpvgqryvlkehiaaqwlstremaildwaeadk
pivrkise

Sequence, based on observed residues (ATOM records): (download)

>d3gwya1 d.113.1.0 (A:2-129) automated matches {Bacteroides fragilis [TaxId: 272559]}
ksievvaavirlgekylcvqrfryefpggkveegeslqealqreimeemdyvievgekll
tvhhtypdfeitmhaflchpvgqryvlkehiaaqwlstremaildwaeadkpivrkise

SCOPe Domain Coordinates for d3gwya1:

Click to download the PDB-style file with coordinates for d3gwya1.
(The format of our PDB-style files is described here.)

Timeline for d3gwya1: