SCOPe 2.07: Domain d3gw8a_: 3gw8 A:

Lineage for d3gw8a_ (3gw8 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:28450] [188843] (3 PDB entries)

8. Domain d3gw8a_: 3gw8 A: [177057]
   automated match to d1e59a_
   complexed with gol, pg4, vo4

Details for d3gw8a_

PDB Entry: 3gw8, 1.93 Å

PDB Description: crystal structure of phosphoglyceromutase from burkholderia pseudomallei with vanadate and glycerol

PDB Compounds: (A:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d3gw8a_:

Sequence; same for both SEQRES and ATOM records:

>d3gw8a_ c.60.1.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr
airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp
ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia
ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylgd

Timeline for d3gw8a_:

• d3gw8a_ first appeared in SCOPe 2.01
  
• d3gw8a_ appears in SCOPe 2.06
  
• d3gw8a_ appears in the current release, SCOPe 2.08