SCOPe 2.06: Domain d3gw1b_: 3gw1 B:

Lineage for d3gw1b_ (3gw1 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)

6. Protein automated matches [190034] (3 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:155892] [188665] (5 PDB entries)

8. Domain d3gw1b_: 3gw1 B: [177053]
   automated match to d1mbuc_
   complexed with mg

Details for d3gw1b_

PDB Entry: 3gw1, 2.36 Å

PDB Description: the structure of the caulobacter crescentus clps protease adaptor protein in complex with fgg tripeptide

PDB Compounds: (B:) ATP-dependent Clp protease adapter protein clpS

SCOPe Domain Sequences for d3gw1b_:

Sequence; same for both SEQRES and ATOM records:

>d3gw1b_ d.45.1.2 (B:) automated matches {Caulobacter vibrioides [TaxId: 155892]}
pslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetk
vaqvidsarrhqhplqctmekd

Timeline for d3gw1b_:

• d3gw1b_ first appeared in SCOPe 2.01
  
• d3gw1b_ appears in SCOPe 2.05
  
• d3gw1b_ appears in SCOPe 2.07
  
• d3gw1b_ appears in the current release, SCOPe 2.08