Lineage for d1guka1 (1guk A:80-219)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270526Protein Class alpha GST [81349] (8 species)
  7. 1270641Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [47628] (2 PDB entries)
  8. 1270644Domain d1guka1: 1guk A:80-219 [17705]
    Other proteins in same PDB: d1guka2, d1gukb2

Details for d1guka1

PDB Entry: 1guk (more details), 2.9 Å

PDB Description: crystal structure of murine alpha-class gsta4-4
PDB Compounds: (A:) glutathione s-transferase a4-4

SCOPe Domain Sequences for d1guka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guka1 a.45.1.1 (A:80-219) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]}
nlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydlilsraktryfpvfeki
lkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisniptikkflq
pgsqrkpppdgpyvevvriv

SCOPe Domain Coordinates for d1guka1:

Click to download the PDB-style file with coordinates for d1guka1.
(The format of our PDB-style files is described here.)

Timeline for d1guka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guka2