SCOPe 2.08: Domain d1guka1: 1guk A:80-219

Lineage for d1guka1 (1guk A:80-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [47628] (2 PDB entries)

8. Domain d1guka1: 1guk A:80-219 [17705]
   Other proteins in same PDB: d1guka2, d1gukb2

Details for d1guka1

PDB Entry: 1guk, 2.9 Å

PDB Description: crystal structure of murine alpha-class gsta4-4

PDB Compounds: (A:) glutathione s-transferase a4-4

SCOPe Domain Sequences for d1guka1:

Sequence; same for both SEQRES and ATOM records:

>d1guka1 a.45.1.1 (A:80-219) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]}
nlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydlilsraktryfpvfeki
lkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisniptikkflq
pgsqrkpppdgpyvevvriv

Timeline for d1guka1:

• d1guka1 first appeared (with stable ids) in SCOP 1.55
  
• d1guka1 appears in SCOPe 2.07