SCOPe 2.07: Domain d3gvyb_: 3gvy B:

Lineage for d3gvyb_ (3gvy B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [189145] (1 PDB entry)

8. Domain d3gvyb_: 3gvy B: [177049]
   automated match to d1jgca_
   complexed with fe, hem

Details for d3gvyb_

PDB Entry: 3gvy, 2.8 Å

PDB Description: crystal structure of bacterioferritin from r.sphaeroides

PDB Compounds: (B:) bacterioferritin

SCOPe Domain Sequences for d3gvyb_:

Sequence; same for both SEQRES and ATOM records:

>d3gvyb_ a.25.1.1 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq
riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf
eeliadeeghidyletqidlmgsigeqnygmlnakpad

Timeline for d3gvyb_:

• d3gvyb_ first appeared in SCOPe 2.01
  
• d3gvyb_ appears in SCOPe 2.06
  
• d3gvyb_ appears in the current release, SCOPe 2.08