Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (21 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:272943] [189145] (1 PDB entry) |
Domain d3gvyb_: 3gvy B: [177049] automated match to d1jgca_ complexed with fe, hem |
PDB Entry: 3gvy (more details), 2.8 Å
SCOPe Domain Sequences for d3gvyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvyb_ a.25.1.1 (B:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} mqgdakvieylnaalrseltavsqywlhyrlqedwgfgsiahksrkesieemhhadkliq riiflgghpnlqrlnplrigqtlretldadlaaehdartlyieardhcekvrdypskmlf eeliadeeghidyletqidlmgsigeqnygmlnakpad
Timeline for d3gvyb_: