SCOPe 2.06: Domain d3gvtb_: 3gvt B:

Lineage for d3gvtb_ (3gvt B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
   this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain

6. Protein automated matches [191057] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188937] (2 PDB entries)

8. Domain d3gvtb_: 3gvt B: [177045]
   automated match to d1m8yb_
   complexed with dtt, gol

Details for d3gvtb_

PDB Entry: 3gvt, 2.8 Å

PDB Description: Structure and RNA binding of the mouse Pumilio-2 Puf Domain

PDB Compounds: (B:) Pumilio homolog 2

SCOPe Domain Sequences for d3gvtb_:

Sequence; same for both SEQRES and ATOM records:

>d3gvtb_ a.118.1.8 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grsrlledfrnnrfpnlqlrdlighivefsqdqhgsrfiqqkleratpaerqivfneilq
aayqlmtdvfgnyviqkffefgsldqklalatrirghvlplalqmygcrviqkalesiss
dqqsemvkeldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfvlsthpygc
rviqrilehctaeqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivseirg
kvlalsqhkfasnvvekcvthasraerallidevccqndgphsalytmmkdqyanyvvqk
midmaepaqrkiimhkirphittlrkytygkhilaklekyyl

Timeline for d3gvtb_:

• d3gvtb_ first appeared in SCOPe 2.01
  
• d3gvtb_ appears in SCOPe 2.05
  
• d3gvtb_ appears in SCOPe 2.07
  
• d3gvtb_ appears in the current release, SCOPe 2.08