Lineage for d3gvoa_ (3gvo A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745416Family a.118.1.8: Pumilio repeat [63611] (2 proteins)
    this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain
  6. 1745441Protein automated matches [191057] (3 species)
    not a true protein
  7. 1745451Species Mouse (Mus musculus) [TaxId:10090] [188937] (2 PDB entries)
  8. 1745452Domain d3gvoa_: 3gvo A: [177041]
    automated match to d1m8yb_
    complexed with dtd, gol

Details for d3gvoa_

PDB Entry: 3gvo (more details), 1.6 Å

PDB Description: structure and rna binding of the mouse pumilio-2 puf domain
PDB Compounds: (A:) Pumilio homolog 2

SCOPe Domain Sequences for d3gvoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvoa_ a.118.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grsrlledfrnnrfpnlqlrdlighivefsqdqhgsrfiqqkleratpaerqivfneilq
aayqlmtdvfgnyviqkffefgsldqklalatrirghvlplalqmygcrviqkalesiss
dqqsemvkeldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfvlsthpygc
rviqrilehctaeqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivseirg
kvlalsqhkfasnvvekcvthasraerallidevccqndgphsalytmmkdqyanyvvqk
midmaepaqrkiimhkirphittlrkytygkhilaklekyyl

SCOPe Domain Coordinates for d3gvoa_:

Click to download the PDB-style file with coordinates for d3gvoa_.
(The format of our PDB-style files is described here.)

Timeline for d3gvoa_: