![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.8: Pumilio repeat [63611] (2 proteins) this is a repeat family; one repeat unit is 1ib2 A:982-1018 found in domain |
![]() | Protein automated matches [191057] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188937] (2 PDB entries) |
![]() | Domain d3gvoa_: 3gvo A: [177041] automated match to d1m8yb_ complexed with dtd, gol |
PDB Entry: 3gvo (more details), 1.6 Å
SCOPe Domain Sequences for d3gvoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvoa_ a.118.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} grsrlledfrnnrfpnlqlrdlighivefsqdqhgsrfiqqkleratpaerqivfneilq aayqlmtdvfgnyviqkffefgsldqklalatrirghvlplalqmygcrviqkalesiss dqqsemvkeldghvlkcvkdqngnhvvqkciecvqpqslqfiidafkgqvfvlsthpygc rviqrilehctaeqtlpileelhqhteqlvqdqygnyviqhvlehgrpedkskivseirg kvlalsqhkfasnvvekcvthasraerallidevccqndgphsalytmmkdqyanyvvqk midmaepaqrkiimhkirphittlrkytygkhilaklekyyl
Timeline for d3gvoa_: