Lineage for d3gvdg_ (3gvd G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806519Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806520Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1806735Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
    this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain
  6. 1806759Protein automated matches [191044] (2 species)
    not a true protein
  7. 1806764Species Yersinia pestis [TaxId:632] [188878] (1 PDB entry)
  8. 1806771Domain d3gvdg_: 3gvd G: [177035]
    automated match to d1t3da_
    complexed with acy, cys, gol, peg, pg5, so4

Details for d3gvdg_

PDB Entry: 3gvd (more details), 2.4 Å

PDB Description: Crystal Structure of Serine Acetyltransferase CysE from Yersinia pestis
PDB Compounds: (G:) Serine acetyltransferase

SCOPe Domain Sequences for d3gvdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvdg_ b.81.1.6 (G:) automated matches {Yersinia pestis [TaxId: 632]}
msseeleqvwsniksearalaecepmlasffhatllkhenlgsalsyilanklanpimpa
iairevveeayrsdahmivsaardilavrlrdpavdkystpllylkgfhalqayrighwl
waqdrkalaiylqnqvsvafgvdihpaatigcgimldhatgivigetavvendvsilqsv
tlggtgktsgdrhpkiregvmigagakilgnievgrgakigagsvvlqsvpahttaagvp
arivgkpesdkpsldmdqhfngs

SCOPe Domain Coordinates for d3gvdg_:

Click to download the PDB-style file with coordinates for d3gvdg_.
(The format of our PDB-style files is described here.)

Timeline for d3gvdg_: