Lineage for d3gvdf_ (3gvd F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423550Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins)
    this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain
  6. 2423574Protein automated matches [191044] (3 species)
    not a true protein
  7. 2423586Species Yersinia pestis [TaxId:632] [188878] (1 PDB entry)
  8. 2423592Domain d3gvdf_: 3gvd F: [177034]
    Other proteins in same PDB: d3gvdb2, d3gvdc2, d3gvdh2, d3gvdi2
    automated match to d1t3da_
    complexed with acy, cys, gol, peg, pg5, so4

Details for d3gvdf_

PDB Entry: 3gvd (more details), 2.4 Å

PDB Description: Crystal Structure of Serine Acetyltransferase CysE from Yersinia pestis
PDB Compounds: (F:) Serine acetyltransferase

SCOPe Domain Sequences for d3gvdf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvdf_ b.81.1.6 (F:) automated matches {Yersinia pestis [TaxId: 632]}
msseeleqvwsniksearalaecepmlasffhatllkhenlgsalsyilanklanpimpa
iairevveeayrsdahmivsaardilavrlrdpavdkystpllylkgfhalqayrighwl
waqdrkalaiylqnqvsvafgvdihpaatigcgimldhatgivigetavvendvsilqsv
tlggtgktsgdrhpkiregvmigagakilgnievgrgakigagsvvlqsvpahttaagvp
arivgkpesdkpsldmdqhfn

SCOPe Domain Coordinates for d3gvdf_:

Click to download the PDB-style file with coordinates for d3gvdf_.
(The format of our PDB-style files is described here.)

Timeline for d3gvdf_: