| Class b: All beta proteins [48724] (180 folds) |
| Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
| Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins) this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain |
| Protein automated matches [191044] (3 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [188878] (1 PDB entry) |
| Domain d3gvdd_: 3gvd D: [177032] Other proteins in same PDB: d3gvdb2, d3gvdc2, d3gvdh2, d3gvdi2 automated match to d1t3da_ complexed with acy, cys, gol, peg, pg5, so4 |
PDB Entry: 3gvd (more details), 2.4 Å
SCOPe Domain Sequences for d3gvdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvdd_ b.81.1.6 (D:) automated matches {Yersinia pestis [TaxId: 632]}
msseeleqvwsniksearalaecepmlasffhatllkhenlgsalsyilanklanpimpa
iairevveeayrsdahmivsaardilavrlrdpavdkystpllylkgfhalqayrighwl
waqdrkalaiylqnqvsvafgvdihpaatigcgimldhatgivigetavvendvsilqsv
tlggtgktsgdrhpkiregvmigagakilgnievgrgakigagsvvlqsvpahttaagvp
arivgkpesdkpsldmdqhfng
Timeline for d3gvdd_: