SCOPe 2.02: Domain d1b48a1: 1b48 A:80-222

Lineage for d1b48a1 (1b48 A:80-222)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Mouse (Mus musculus), (a1-4) [TaxId:10090] [47628] (2 PDB entries)

8. Domain d1b48a1: 1b48 A:80-222 [17703]
   Other proteins in same PDB: d1b48a2, d1b48b2
   complexed with gsh, hag

Details for d1b48a1

PDB Entry: 1b48, 2.6 Å

PDB Description: crystal structure of mgsta4-4 in complex with gsh conjugate of 4-hydroxynonenal in one subunit and gsh in the other: evidence of signaling across dimer interface in mgsta4-4

PDB Compounds: (A:) protein (glutathione s-transferase)

SCOPe Domain Sequences for d1b48a1:

Sequence; same for both SEQRES and ATOM records:

>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]}
nlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydlilsraktryfpvfeki
lkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisniptikkflq
pgsqrkpppdgpyvevvrivlkf

Timeline for d1b48a1:

• d1b48a1 first appeared (with stable ids) in SCOP 1.55
  
• d1b48a1 appears in SCOPe 2.01
  
• d1b48a1 appears in SCOPe 2.03
  
• d1b48a1 appears in the current release, SCOPe 2.08