Class b: All beta proteins [48724] (177 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.6: Serine acetyltransferase [110309] (2 proteins) this is a repeat family; one repeat unit is 1t3d A:205-223 found in domain |
Protein automated matches [191044] (2 species) not a true protein |
Species Yersinia pestis [TaxId:632] [188878] (1 PDB entry) |
Domain d3gvda_: 3gvd A: [177029] Other proteins in same PDB: d3gvdb2, d3gvdc2, d3gvdh2, d3gvdi2 automated match to d1t3da_ complexed with acy, cys, gol, peg, pg5, so4 |
PDB Entry: 3gvd (more details), 2.4 Å
SCOPe Domain Sequences for d3gvda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvda_ b.81.1.6 (A:) automated matches {Yersinia pestis [TaxId: 632]} msseeleqvwsniksearalaecepmlasffhatllkhenlgsalsyilanklanpimpa iairevveeayrsdahmivsaardilavrlrdpavdkystpllylkgfhalqayrighwl waqdrkalaiylqnqvsvafgvdihpaatigcgimldhatgivigetavvendvsilqsv tlggtgktsgdrhpkiregvmigagakilgnievgrgakigagsvvlqsvpahttaagvp arivgkpesdkpsldmdqhfngsiqgfeygd
Timeline for d3gvda_: