SCOPe 2.06: Domain d3gv6a_: 3gv6 A:

Lineage for d3gv6a_ (3gv6 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188859] (13 PDB entries)

8. Domain d3gv6a_: 3gv6 A: [177024]
   automated match to d2dnva1
   protein/DNA complex

Details for d3gv6a_

PDB Entry: 3gv6, 1.76 Å

PDB Description: Crystal Structure of human chromobox homolog 6 (CBX6) with H3K9 peptide

PDB Compounds: (A:) Chromobox protein homolog 6

SCOPe Domain Sequences for d3gv6a_:

Sequence; same for both SEQRES and ATOM records:

>d3gv6a_ b.34.13.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ervfaaesiikrrirkgrieylvkwkgwaikystwepeenildsrliaafeqkere

Timeline for d3gv6a_:

• d3gv6a_ first appeared in SCOPe 2.01
  
• d3gv6a_ appears in SCOPe 2.05
  
• d3gv6a_ appears in SCOPe 2.07
  
• d3gv6a_ appears in the current release, SCOPe 2.08