SCOPe 2.07: Domain d3guob_: 3guo B:

Lineage for d3guob_ (3guo B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (572 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3guob_: 3guo B: [177020]
   automated match to d1l19a_
   complexed with ca, cl, iph; mutant

Details for d3guob_

PDB Entry: 3guo, 2.16 Å

PDB Description: t4 lysozyme m102e/l99a mutant with buried charge in apolar cavity-- phenol binding

PDB Compounds: (B:) lysozyme

SCOPe Domain Sequences for d3guob_:

Sequence; same for both SEQRES and ATOM records:

>d3guob_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdcegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainevfqmgvtgvagftnvlrm
lqqkrwdeaavnlaksrwynqcpdrakrvittfrtgtwdayk

Timeline for d3guob_:

• d3guob_ first appeared in SCOPe 2.01
  
• d3guob_ appears in SCOPe 2.06