Lineage for d1f3bb1 (1f3b B:80-222)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270526Protein Class alpha GST [81349] (8 species)
  7. 1270636Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [47627] (2 PDB entries)
  8. 1270638Domain d1f3bb1: 1f3b B:80-222 [17700]
    Other proteins in same PDB: d1f3ba2, d1f3bb2
    complexed with gbx

Details for d1f3bb1

PDB Entry: 1f3b (more details), 2 Å

PDB Description: crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide
PDB Compounds: (B:) glutathione s-transferase ya chain

SCOPe Domain Sequences for d1f3bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3bb1 a.45.1.1 (B:80-222) Class alpha GST {Mouse (Mus musculus), (a1-1) [TaxId: 10090]}
lygkdmkeralidmysegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllevllyveefdaslltpfpllkafksrisslpnvkkflqp
gsqrkppmdakqiqearkafkiq

SCOPe Domain Coordinates for d1f3bb1:

Click to download the PDB-style file with coordinates for d1f3bb1.
(The format of our PDB-style files is described here.)

Timeline for d1f3bb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f3bb2