SCOP 1.69: Domain d1f3ba1: 1f3b A:80-222

Lineage for d1f3ba1 (1f3b A:80-222)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Mouse (Mus musculus), (a1-1) [TaxId:10090] [47627] (2 PDB entries)

8. Domain d1f3ba1: 1f3b A:80-222 [17699]
   Other proteins in same PDB: d1f3ba2, d1f3bb2

Details for d1f3ba1

PDB Entry: 1f3b, 2 Å

PDB Description: crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide

SCOP Domain Sequences for d1f3ba1:

Sequence; same for both SEQRES and ATOM records:

>d1f3ba1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-1)}
lygkdmkeralidmysegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdihllevllyveefdaslltpfpllkafksrisslpnvkkflqp
gsqrkppmdakqiqearkafkiq

Timeline for d1f3ba1:

• d1f3ba1 first appeared (with stable ids) in SCOP 1.55
  
• d1f3ba1 appears in SCOP 1.67
  
• d1f3ba1 appears in SCOP 1.71
  
• d1f3ba1 appears in the current release, SCOPe 2.08