![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class alpha GST [81349] (8 species) |
![]() | Species Norway rat (Rattus norvegicus), (a1-1) [TaxId:10116] [47626] (2 PDB entries) |
![]() | Domain d1ev9c1: 1ev9 C:80-208 [17697] Other proteins in same PDB: d1ev9a2, d1ev9c2, d1ev9d2 complexed with gts, so4; mutant |
PDB Entry: 1ev9 (more details), 2.2 Å
SCOPe Domain Sequences for d1ev9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev9c1 a.45.1.1 (C:80-208) Class alpha GST {Norway rat (Rattus norvegicus), (a1-1) [TaxId: 10116]} dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq pgsqrklpm
Timeline for d1ev9c1:
![]() Domains from other chains: (mouse over for more information) d1ev9a1, d1ev9a2, d1ev9d1, d1ev9d2 |