Lineage for d3gsma_ (3gsm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083464Family c.1.8.7: NagZ-like [51553] (4 protein domains)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 2083502Protein automated matches [191056] (3 species)
    not a true protein
  7. 2083515Species Vibrio cholerae [TaxId:666] [188936] (2 PDB entries)
  8. 2083517Domain d3gsma_: 3gsm A: [176967]
    automated match to d1tr9a_
    complexed with gol, vpu

Details for d3gsma_

PDB Entry: 3gsm (more details), 2.4 Å

PDB Description: Vibrio cholerae family 3 glycoside hydrolase (NagZ) bound to N-Valeryl-PUGNAc
PDB Compounds: (A:) Beta-hexosaminidase

SCOPe Domain Sequences for d3gsma_:

Sequence, based on SEQRES records: (download)

>d3gsma_ c.1.8.7 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
mgplwldvagyelsaedrailahptvggvilfgrnyhdnqqllalnkairqaaarpilig
vdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldm
gfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyde
retiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgivf
sddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallkk
qqfsyselkrlerwqqasanmqrlieqfs

Sequence, based on observed residues (ATOM records): (download)

>d3gsma_ c.1.8.7 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
mgplwldvagyelsaedrailahptvggvilfgrnyhdnqqllalnkairqaaarpilig
vdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldm
gfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadhletpyder
etiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgivfs
ddlsmvmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallkkqqfsy
selkrlerwqqasanmqrlieqfs

SCOPe Domain Coordinates for d3gsma_:

Click to download the PDB-style file with coordinates for d3gsma_.
(The format of our PDB-style files is described here.)

Timeline for d3gsma_: