Lineage for d3gshb_ (3gsh B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328002Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2328003Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2328004Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2328012Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 2328013Species Barley (Hordeum vulgare) [TaxId:4513] [47705] (6 PDB entries)
  8. 2328018Domain d3gshb_: 3gsh B: [176966]
    automated match to d1be2a_
    complexed with asy, na, tfa, zn

Details for d3gshb_

PDB Entry: 3gsh (more details), 1.8 Å

PDB Description: three-dimensional structure of a post translational modified barley ltp1
PDB Compounds: (B:) Non-specific lipid-transfer protein 1

SCOPe Domain Sequences for d3gshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gshb_ a.52.1.1 (B:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Barley (Hordeum vulgare) [TaxId: 4513]}
lncgqvdskmkpcltyvqggpgpsgeccngvrdlhnqaqssgdrqtvcnclkgiargihn
lnlnnaasipskcnvnvpytispdidcsriy

SCOPe Domain Coordinates for d3gshb_:

Click to download the PDB-style file with coordinates for d3gshb_.
(The format of our PDB-style files is described here.)

Timeline for d3gshb_: