Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
Protein automated matches [191031] (2 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [188846] (1 PDB entry) |
Domain d3gsdl_: 3gsd L: [176961] automated match to d1naqa_ complexed with edo, epe, na, peg |
PDB Entry: 3gsd (more details), 2.05 Å
SCOPe Domain Sequences for d3gsdl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gsdl_ d.58.5.2 (L:) automated matches {Yersinia pestis [TaxId: 214092]} ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
Timeline for d3gsdl_: