Lineage for d3gsdk_ (3gsd K:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907588Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 1907670Protein automated matches [191031] (3 species)
    not a true protein
  7. 1907679Species Yersinia pestis [TaxId:214092] [188846] (1 PDB entry)
  8. 1907690Domain d3gsdk_: 3gsd K: [176960]
    automated match to d1naqa_
    complexed with edo, epe, na, peg

Details for d3gsdk_

PDB Entry: 3gsd (more details), 2.05 Å

PDB Description: 2.05 angstrom structure of a divalent-cation tolerance protein (cuta) from yersinia pestis
PDB Compounds: (K:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3gsdk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsdk_ d.58.5.2 (K:) automated matches {Yersinia pestis [TaxId: 214092]}
ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll

SCOPe Domain Coordinates for d3gsdk_:

Click to download the PDB-style file with coordinates for d3gsdk_.
(The format of our PDB-style files is described here.)

Timeline for d3gsdk_: