Lineage for d3gsdh_ (3gsd H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950826Protein automated matches [191031] (3 species)
    not a true protein
  7. 2950835Species Yersinia pestis [TaxId:214092] [188846] (1 PDB entry)
  8. 2950843Domain d3gsdh_: 3gsd H: [176957]
    automated match to d1naqa_
    complexed with edo, epe, na, peg

Details for d3gsdh_

PDB Entry: 3gsd (more details), 2.05 Å

PDB Description: 2.05 angstrom structure of a divalent-cation tolerance protein (cuta) from yersinia pestis
PDB Compounds: (H:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3gsdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsdh_ d.58.5.2 (H:) automated matches {Yersinia pestis [TaxId: 214092]}
ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll

SCOPe Domain Coordinates for d3gsdh_:

Click to download the PDB-style file with coordinates for d3gsdh_.
(The format of our PDB-style files is described here.)

Timeline for d3gsdh_: