| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
| Protein automated matches [191031] (3 species) not a true protein |
| Species Yersinia pestis [TaxId:214092] [188846] (1 PDB entry) |
| Domain d3gsdh_: 3gsd H: [176957] automated match to d1naqa_ complexed with edo, epe, na, peg |
PDB Entry: 3gsd (more details), 2.05 Å
SCOPe Domain Sequences for d3gsdh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gsdh_ d.58.5.2 (H:) automated matches {Yersinia pestis [TaxId: 214092]}
ysnaivvlctapdeasaqnlaaqvlgeklaacvtllpgatslyywegkleqeyevqllfk
sntdhqqalltyikqhhpyqtpellvlpvrdgdkdylswlnasll
Timeline for d3gsdh_: