Lineage for d3groa_ (3gro A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900663Family c.69.1.13: Thioesterases [53542] (4 proteins)
  6. 2900676Protein automated matches [191030] (1 species)
    not a true protein
  7. 2900677Species Human (Homo sapiens) [TaxId:9606] [188844] (1 PDB entry)
  8. 2900678Domain d3groa_: 3gro A: [176941]
    automated match to d1eh5a_
    complexed with unx

Details for d3groa_

PDB Entry: 3gro (more details), 2.53 Å

PDB Description: human palmitoyl-protein thioesterase 1
PDB Compounds: (A:) Palmitoyl-protein thioesterase 1

SCOPe Domain Sequences for d3groa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3groa_ c.69.1.13 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
paplplviwhgmgdsccnplsmgaikkmvekkipgiyvlsleigktlmedvensfflnvn
sqvttvcqalakdpklqqgynamgfsqggqflravaqrcpsppminlisvggqhqgvfgl
prcpgesshicdfirktlnagayskvvqerlvqaeywhdpikedvyrnhsifladinqer
ginesykknlmalkkfvmvkflndsivdpvdsewfgfyrsgqaketiplqetslytqdrl
glkemdnagqlvflategdhlqlseewfyahiipflg

SCOPe Domain Coordinates for d3groa_:

Click to download the PDB-style file with coordinates for d3groa_.
(The format of our PDB-style files is described here.)

Timeline for d3groa_: