SCOP 1.57: Domain d1ev4c1: 1ev4 C:80-208

Lineage for d1ev4c1 (1ev4 C:80-208)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (3 proteins)

6. Protein Glutathione S-transferase [47618] (24 species)

7. Species Rat (Rattus norvegicus), class alpha (a1-1) [TaxId:10116] [47626] (2 PDB entries)

8. Domain d1ev4c1: 1ev4 C:80-208 [17694]
   Other proteins in same PDB: d1ev4a2, d1ev4c2, d1ev4d2

Details for d1ev4c1

PDB Entry: 1ev4, 2.2 Å

PDB Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound

SCOP Domain Sequences for d1ev4c1:

Sequence; same for both SEQRES and ATOM records:

>d1ev4c1 a.45.1.1 (C:80-208) Glutathione S-transferase {Rat (Rattus norvegicus), class alpha (a1-1)}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpm

Timeline for d1ev4c1:

• d1ev4c1 first appeared (with stable ids) in SCOP 1.55
  
• d1ev4c1 appears in SCOP 1.59
  
• d1ev4c1 appears in the current release, SCOPe 2.08