Lineage for d1ev4c1 (1ev4 C:80-208)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3896Species Rat (Rattus norvegicus), class alpha (a1-1) [TaxId:10116] [47626] (2 PDB entries)
  8. 3898Domain d1ev4c1: 1ev4 C:80-208 [17694]
    Other proteins in same PDB: d1ev4a2, d1ev4c2, d1ev4d2

Details for d1ev4c1

PDB Entry: 1ev4 (more details), 2.2 Å

PDB Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound

SCOP Domain Sequences for d1ev4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev4c1 a.45.1.1 (C:80-208) Glutathione S-transferase {Rat (Rattus norvegicus), class alpha (a1-1)}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpm

SCOP Domain Coordinates for d1ev4c1:

Click to download the PDB-style file with coordinates for d1ev4c1.
(The format of our PDB-style files is described here.)

Timeline for d1ev4c1: