Lineage for d3gqre_ (3gqr E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688593Species Cat (Felis catus) [TaxId:9685] [188888] (4 PDB entries)
  8. 2688606Domain d3gqre_: 3gqr E: [176920]
    automated match to d1a00a_
    complexed with hem

Details for d3gqre_

PDB Entry: 3gqr (more details), 2.4 Å

PDB Description: crystal structure determination of cat (felis silvestris catus) hemoglobin at 2.4 angstrom resolution
PDB Compounds: (E:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3gqre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqre_ a.1.1.2 (E:) automated matches {Cat (Felis catus) [TaxId: 9685]}
vlsaadksnvkacwgkigshageygaealertfcsfpttktyfphfdlshgsaqvkahgq
kvadaltqavahmddlptamsalsdlhayklrvdpvnfkflshcllvtlachhpaeftpa
vhasldkffsavstvltskyr

SCOPe Domain Coordinates for d3gqre_:

Click to download the PDB-style file with coordinates for d3gqre_.
(The format of our PDB-style files is described here.)

Timeline for d3gqre_: