Lineage for d1agsb1 (1ags B:80-221)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3713Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [47625] (7 PDB entries)
  8. 3739Domain d1agsb1: 1ags B:80-221 [17692]
    Other proteins in same PDB: d1agsa2, d1agsb2

Details for d1agsb1

PDB Entry: 1ags (more details), 2.5 Å

PDB Description: a surface mutant (g82r) of a human alpha-glutathione s-transferase shows decreased thermal stability and a new mode of molecular association in the crystal

SCOP Domain Sequences for d1agsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agsb1 a.45.1.1 (B:80-221) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)}
lyrkdikekalidmyiegiadlgemilllpftqpeeqdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOP Domain Coordinates for d1agsb1:

Click to download the PDB-style file with coordinates for d1agsb1.
(The format of our PDB-style files is described here.)

Timeline for d1agsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agsb2