Lineage for d3gqpc_ (3gqp C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302043Species Cat (Felis catus) [TaxId:9685] [188888] (4 PDB entries)
  8. 2302046Domain d3gqpc_: 3gqp C: [176917]
    automated match to d1a00a_
    complexed with hem

Details for d3gqpc_

PDB Entry: 3gqp (more details), 2 Å

PDB Description: crystal structure determination of cat (felis silvestris catus) hemoglobin at 2.0 angstrom resolution
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3gqpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqpc_ a.1.1.2 (C:) automated matches {Cat (Felis catus) [TaxId: 9685]}
vlsaadksnvkacwgkigshageygaealertfcsfpttktyfphfdlshgsaqvkahgq
kvadaltqavahmddlptamsalsdlhayklrvdpvnfkflshcllvtlachhpaeftpa
vhasldkffsavstvltskyr

SCOPe Domain Coordinates for d3gqpc_:

Click to download the PDB-style file with coordinates for d3gqpc_.
(The format of our PDB-style files is described here.)

Timeline for d3gqpc_: