SCOPe 2.03: Domain d3gqgd_: 3gqg D:

Lineage for d3gqgd_ (3gqg D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (11 PDB entries)

8. Domain d3gqgd_: 3gqg D: [176912]
   Other proteins in same PDB: d3gqga_, d3gqgc_
   automated match to d1hbhb_
   complexed with hem

Details for d3gqgd_

PDB Entry: 3gqg, 1.73 Å

PDB Description: Crystal structure at acidic pH of the ferric form of the Root effect hemoglobin from Trematomus bernacchii.

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3gqgd_:

Sequence; same for both SEQRES and ATOM records:

>d3gqgd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d3gqgd_:

• d3gqgd_ first appeared in SCOPe 2.01
  
• d3gqgd_ appears in SCOPe 2.02
  
• d3gqgd_ appears in SCOPe 2.04
  
• d3gqgd_ appears in the current release, SCOPe 2.08