SCOPe 2.02: Domain d3gq1a_: 3gq1 A:

Lineage for d3gq1a_ (3gq1 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.45: ClpS-like [54735] (1 superfamily)
   beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta

4. Superfamily d.45.1: ClpS-like [54736] (3 families)

5. Family d.45.1.2: Adaptor protein ClpS (YljA) [82641] (2 proteins)

6. Protein automated matches [190034] (3 species)
   not a true protein

7. Species Caulobacter vibrioides [TaxId:155892] [188665] (5 PDB entries)

8. Domain d3gq1a_: 3gq1 A: [176901]
   automated match to d1mbuc_
   complexed with mg

Details for d3gq1a_

PDB Entry: 3gq1, 1.5 Å

PDB Description: the structure of the caulobacter crescentus clps protease adaptor protein in complex with a wlfvqrdske decapeptide

PDB Compounds: (A:) ATP-dependent Clp protease adapter protein clpS

SCOPe Domain Sequences for d3gq1a_:

Sequence; same for both SEQRES and ATOM records:

>d3gq1a_ d.45.1.2 (A:) automated matches {Caulobacter vibrioides [TaxId: 155892]}
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

Timeline for d3gq1a_:

• d3gq1a_ first appeared in SCOPe 2.01
  
• d3gq1a_ appears in SCOPe 2.03
  
• d3gq1a_ appears in the current release, SCOPe 2.08