Lineage for d1gumc1 (1gum C:81-220)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326004Protein Class alpha GST [81349] (8 species)
  7. 2326017Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
    Uniprot P08263
  8. 2326119Domain d1gumc1: 1gum C:81-220 [17685]
    Other proteins in same PDB: d1guma2, d1gumb2, d1gumc2, d1gumd2, d1gume2, d1gumf2, d1gumg2, d1gumh2

Details for d1gumc1

PDB Entry: 1gum (more details), 3 Å

PDB Description: human glutathione transferase a4-4 without ligands
PDB Compounds: (C:) protein (glutathione transferase a4-4)

SCOPe Domain Sequences for d1gumc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gumc1 a.45.1.1 (C:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

SCOPe Domain Coordinates for d1gumc1:

Click to download the PDB-style file with coordinates for d1gumc1.
(The format of our PDB-style files is described here.)

Timeline for d1gumc1: