Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (19 PDB entries) Uniprot P08263 |
Domain d1guma1: 1gum A:81-220 [17683] Other proteins in same PDB: d1guma2, d1gumb2, d1gumc2, d1gumd2, d1gume2, d1gumf2, d1gumg2, d1gumh2 |
PDB Entry: 1gum (more details), 3 Å
SCOPe Domain Sequences for d1guma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1guma1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep gskkkpppdeiyvrtvynif
Timeline for d1guma1: