SCOPe 2.02: Domain d1guma1: 1gum A:81-220

Lineage for d1guma1 (1gum A:81-220)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (19 PDB entries)
   Uniprot P08263

8. Domain d1guma1: 1gum A:81-220 [17683]
   Other proteins in same PDB: d1guma2, d1gumb2, d1gumc2, d1gumd2, d1gume2, d1gumf2, d1gumg2, d1gumh2

Details for d1guma1

PDB Entry: 1gum, 3 Å

PDB Description: human glutathione transferase a4-4 without ligands

PDB Compounds: (A:) protein (glutathione transferase a4-4)

SCOPe Domain Sequences for d1guma1:

Sequence; same for both SEQRES and ATOM records:

>d1guma1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lfgknlkertlidmyvegtldllellimhpflkpddqqkevvnmaqkaiiryfpvfekil
rghgqsflvgnqlsladvillqtilaleekipnilsafpflqeytvklsniptikrflep
gskkkpppdeiyvrtvynif

Timeline for d1guma1:

• d1guma1 first appeared (with stable ids) in SCOP 1.55
  
• d1guma1 appears in SCOPe 2.01
  
• d1guma1 appears in SCOPe 2.03
  
• d1guma1 appears in the current release, SCOPe 2.08