Lineage for d3gpjg_ (3gpj G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993479Domain d3gpjg_: 3gpj G: [176824]
    Other proteins in same PDB: d3gpj1_, d3gpj2_, d3gpja_, d3gpjb_, d3gpjc_, d3gpjd_, d3gpje_, d3gpjf_, d3gpjh_, d3gpji_, d3gpjj_, d3gpjk_, d3gpjl_, d3gpjm_, d3gpjn_, d3gpjo_, d3gpjp_, d3gpjq_, d3gpjr_, d3gpjs_, d3gpjt_, d3gpjv_, d3gpjw_, d3gpjx_, d3gpjy_, d3gpjz_
    automated match to d1g65g_
    complexed with sy2

Details for d3gpjg_

PDB Entry: 3gpj (more details), 2.7 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with syringolin B
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3gpjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpjg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3gpjg_:

Click to download the PDB-style file with coordinates for d3gpjg_.
(The format of our PDB-style files is described here.)

Timeline for d3gpjg_: