SCOPe 2.02: Domain d3gpaf_: 3gpa F:

Lineage for d3gpaf_ (3gpa F:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (10 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (24 PDB entries)

8. Domain d3gpaf_: 3gpa F: [176815]
   automated match to d2b8pa1
   complexed with cdp, mg, po4; mutant

Details for d3gpaf_

PDB Entry: 3gpa, 2 Å

PDB Description: crystal structure of the mimivirus ndk n62l mutant complexed with cdp

PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3gpaf_:

Sequence; same for both SEQRES and ATOM records:

>d3gpaf_ d.58.6.1 (F:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
ndlcdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
avdeisiwfp

Timeline for d3gpaf_:

• d3gpaf_ first appeared in SCOPe 2.01
  
• d3gpaf_ appears in SCOPe 2.03
  
• d3gpaf_ appears in the current release, SCOPe 2.08, called d3gpaf1