SCOPe 2.06: Domain d3gpaa1: 3gpa A:2-130

Lineage for d3gpaa1 (3gpa A:2-130)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3gpaa1: 3gpa A:2-130 [176810]
   Other proteins in same PDB: d3gpaa2, d3gpab2, d3gpac2, d3gpad2, d3gpae2, d3gpaf2
   automated match to d2b8pa1
   complexed with cdp, mg, po4; mutant

Details for d3gpaa1

PDB Entry: 3gpa, 2 Å

PDB Description: crystal structure of the mimivirus ndk n62l mutant complexed with cdp

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3gpaa1:

Sequence; same for both SEQRES and ATOM records:

>d3gpaa1 d.58.6.1 (A:2-130) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
lcdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfpe

Timeline for d3gpaa1:

• d3gpaa1 first appeared in SCOPe 2.01, called d3gpaa_
  
• d3gpaa1 was called d3gpaa_ in SCOPe 2.05
  
• d3gpaa1 appears in SCOPe 2.07
  
• d3gpaa1 appears in the current release, SCOPe 2.08