SCOPe 2.08: Domain d3gp9e1: 3gp9 E:2-131

Lineage for d3gp9e1 (3gp9 E:2-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries)

8. Domain d3gp9e1: 3gp9 E:2-131 [176808]
   Other proteins in same PDB: d3gp9a2, d3gp9b2, d3gp9c2, d3gp9d2, d3gp9e2, d3gp9f2
   automated match to d2b8pa1
   complexed with gdp, mg, po4

Details for d3gp9e1

PDB Entry: 3gp9, 1.8 Å

PDB Description: Crystal structure of the Mimivirus NDK complexed with GDP

PDB Compounds: (E:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3gp9e1:

Sequence; same for both SEQRES and ATOM records:

>d3gp9e1 d.58.6.1 (E:2-131) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfpet

Timeline for d3gp9e1:

• d3gp9e1 first appeared in SCOPe 2.01, called d3gp9e_
  
• d3gp9e1 appears in SCOPe 2.07